Lineage for d1bg5a1 (1bg5 A:81-254)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712988Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
    Uniprot P08515
  8. 2713006Domain d1bg5a1: 1bg5 A:81-254 [17723]
    Other proteins in same PDB: d1bg5a2
    fused with ankyrin binding domain of alpha-Na,K-ATPase

Details for d1bg5a1

PDB Entry: 1bg5 (more details), 2.6 Å

PDB Description: crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase
PDB Compounds: (A:) fusion protein of alpha-na,k-ATPase with glutathione s-transferase

SCOPe Domain Sequences for d1bg5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg5a1 a.45.1.1 (A:81-254) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppksdlvprgssyyqeaksskimesfknmvpqqalvnss

SCOPe Domain Coordinates for d1bg5a1:

Click to download the PDB-style file with coordinates for d1bg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1bg5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bg5a2