SCOPe 2.08: Domain d1bg5a1: 1bg5 A:81-254

Lineage for d1bg5a1 (1bg5 A:81-254)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
   Uniprot P08515

8. Domain d1bg5a1: 1bg5 A:81-254 [17723]
   Other proteins in same PDB: d1bg5a2
   fused with ankyrin binding domain of alpha-Na,K-ATPase

Details for d1bg5a1

PDB Entry: 1bg5, 2.6 Å

PDB Description: crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase

PDB Compounds: (A:) fusion protein of alpha-na,k-ATPase with glutathione s-transferase

SCOPe Domain Sequences for d1bg5a1:

Sequence; same for both SEQRES and ATOM records:

>d1bg5a1 a.45.1.1 (A:81-254) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppksdlvprgssyyqeaksskimesfknmvpqqalvnss

Timeline for d1bg5a1:

• d1bg5a1 first appeared (with stable ids) in SCOP 1.55, called d1bg5_1
  
• d1bg5a1 appears in SCOPe 2.07