SCOPe 2.05: Domain d3h6aa_: 3h6a A:

Lineage for d3h6aa_ (3h6a A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.0: automated matches [191575] (1 protein)
   not a true family

6. Protein automated matches [191010] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188932] (3 PDB entries)

8. Domain d3h6aa_: 3h6a A: [177225]
   automated match to d2fwsa1

Details for d3h6aa_

PDB Entry: 3h6a, 1.61 Å

PDB Description: Structure of the Calx-beta domain of integrin beta4 crystallized in the presence of calcium

PDB Compounds: (A:) Integrin beta-4

SCOPe Domain Sequences for d3h6aa_:

Sequence, based on SEQRES records:

>d3h6aa_ b.1.27.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegell
fqpgeawkelqvkllelqevdsllrgrqvrrfhvqlsnpkfgahlgqphsttiiirdp

Sequence, based on observed residues (ATOM records):

>d3h6aa_ b.1.27.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrdvvsfeqpefsvsrgdqvaripvirrvldggksqvsyrtqdgtaqgnrdyipvegell
fqpgeawkelqvkllelrqvrrfhvqlsnpkfgahlgqphsttiiirdp

Timeline for d3h6aa_:

• d3h6aa_ first appeared in SCOPe 2.01
  
• d3h6aa_ appears in SCOPe 2.04
  
• d3h6aa_ is called d3h6aa1 in SCOPe 2.06
  
• d3h6aa_ appears in the current release, SCOPe 2.08, called d3h6aa1