SCOPe 2.07: Domain d1gtba1: 1gtb A:81-218

Lineage for d1gtba1 (1gtb A:81-218)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
   Uniprot P08515

8. Domain d1gtba1: 1gtb A:81-218 [17722]
   Other proteins in same PDB: d1gtba2
   complexed with pzq

Details for d1gtba1

PDB Entry: 1gtb, 2.6 Å

PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gtba1:

Sequence; same for both SEQRES and ATOM records:

>d1gtba1 a.45.1.1 (A:81-218) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppk

Timeline for d1gtba1:

• d1gtba1 first appeared (with stable ids) in SCOP 1.55, called d1gtb_1
  
• d1gtba1 appears in SCOPe 2.06
  
• d1gtba1 appears in the current release, SCOPe 2.08