Lineage for d1gtba1 (1gtb A:81-218)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491614Protein Class alpha GST [81349] (8 species)
  7. 1491740Species Schistosoma japonicum [TaxId:6182] [47633] (13 PDB entries)
    Uniprot P08515
  8. 1491751Domain d1gtba1: 1gtb A:81-218 [17722]
    Other proteins in same PDB: d1gtba2
    complexed with pzq

Details for d1gtba1

PDB Entry: 1gtb (more details), 2.6 Å

PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gtba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtba1 a.45.1.1 (A:81-218) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppk

SCOPe Domain Coordinates for d1gtba1:

Click to download the PDB-style file with coordinates for d1gtba1.
(The format of our PDB-style files is described here.)

Timeline for d1gtba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gtba2