![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries) Uniprot P08515 |
![]() | Domain d1gtba1: 1gtb A:81-218 [17722] Other proteins in same PDB: d1gtba2 complexed with pzq |
PDB Entry: 1gtb (more details), 2.6 Å
SCOPe Domain Sequences for d1gtba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtba1 a.45.1.1 (A:81-218) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia wplqgwqatfgggdhppk
Timeline for d1gtba1: