SCOPe 2.08: Domain d3h61d_: 3h61 D:

Lineage for d3h61d_ (3h61 D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries)
   Uniprot P53041 176-499

8. Domain d3h61d_: 3h61 D: [177210]
   automated match to d1s95a_
   complexed with enl, mn

Details for d3h61d_

PDB Entry: 3h61, 1.45 Å

PDB Description: Catalytic domain of human Serine/Threonine Phosphatase 5 (PP5c) with two Mn2+ atoms originally soaked with norcantharidin (which is present in the structure in the hydrolyzed form)

PDB Compounds: (D:) Serine/threonine-protein phosphatase 5

SCOPe Domain Sequences for d3h61d_:

Sequence; same for both SEQRES and ATOM records:

>d3h61d_ d.159.1.3 (D:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmaya

Timeline for d3h61d_:

• d3h61d_ first appeared in SCOPe 2.01
  
• d3h61d_ appears in SCOPe 2.07