Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries) Uniprot P53041 176-499 |
Domain d3h61d_: 3h61 D: [177210] automated match to d1s95a_ complexed with enl, mn |
PDB Entry: 3h61 (more details), 1.45 Å
SCOPe Domain Sequences for d3h61d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h61d_ d.159.1.3 (D:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq ftavphpnvkpmaya
Timeline for d3h61d_: