SCOP 1.69: Domain d1gta_1: 1gta 81-218

Lineage for d1gta_1 (1gta 81-218)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (9 PDB entries)

8. Domain d1gta_1: 1gta 81-218 [17720]
   Other proteins in same PDB: d1gta_2

Details for d1gta_1

PDB Entry: 1gta, 2.4 Å

PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel

SCOP Domain Sequences for d1gta_1:

Sequence; same for both SEQRES and ATOM records:

>d1gta_1 a.45.1.1 (81-218) Class alpha GST {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppk

Timeline for d1gta_1:

• d1gta_1 first appeared (with stable ids) in SCOP 1.55
  
• d1gta_1 appears in SCOP 1.67
  
• d1gta_1 appears in SCOP 1.71
  
• d1gta_1 appears in the current release, SCOPe 2.08, called d1gtaa1