Lineage for d3h5bb_ (3h5b B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 955289Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 955305Protein Human immunodeficiency virus type 1 protease [50632] (5 species)
  7. 955367Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 955445Domain d3h5bb_: 3h5b B: [177198]
    automated match to d1fgcc_
    complexed with 031, cl, gol, na

Details for d3h5bb_

PDB Entry: 3h5b (more details), 1.29 Å

PDB Description: crystal structure of wild type hiv-1 protease with novel p1'-ligand grl-02031
PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d3h5bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h5bb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3h5bb_:

Click to download the PDB-style file with coordinates for d3h5bb_.
(The format of our PDB-style files is described here.)

Timeline for d3h5bb_: