SCOPe 2.03: Domain d3h5ba_: 3h5b A:

Lineage for d3h5ba_ (3h5b A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (19 PDB entries)

8. Domain d3h5ba_: 3h5b A: [177197]
   automated match to d1fgcc_
   complexed with 031, cl, gol, na

Details for d3h5ba_

PDB Entry: 3h5b, 1.29 Å

PDB Description: crystal structure of wild type hiv-1 protease with novel p1'-ligand grl-02031

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d3h5ba_:

Sequence; same for both SEQRES and ATOM records:

>d3h5ba_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3h5ba_:

• d3h5ba_ first appeared in SCOPe 2.01
  
• d3h5ba_ appears in SCOPe 2.02
  
• d3h5ba_ appears in SCOPe 2.04
  
• d3h5ba_ appears in the current release, SCOPe 2.08