SCOPe 2.07: Domain d3h57a_: 3h57 A:

Lineage for d3h57a_ (3h57 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 protein domains)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (297 PDB entries)
   Uniprot P02185

8. Domain d3h57a_: 3h57 A: [177193]
   automated match to d2mgca_
   complexed with hem; mutant

Details for d3h57a_

PDB Entry: 3h57, 1.7 Å

PDB Description: Myoglobin Cavity Mutant H64LV68N Deoxy form

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3h57a_:

Sequence; same for both SEQRES and ATOM records:

>d3h57a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkklgvtnltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d3h57a_:

• d3h57a_ first appeared in SCOPe 2.01
  
• d3h57a_ appears in SCOPe 2.06