Lineage for d3h52c1 (3h52 C:528-776)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009648Domain d3h52c1: 3h52 C:528-776 [177191]
    Other proteins in same PDB: d3h52a2, d3h52c2
    automated match to d1m2za_
    complexed with 486, gol

Details for d3h52c1

PDB Entry: 3h52 (more details), 2.8 Å

PDB Description: Crystal structure of the antagonist form of human glucocorticoid receptor
PDB Compounds: (C:) Glucocorticoid receptor

SCOPe Domain Sequences for d3h52c1:

Sequence, based on SEQRES records: (download)

>d3h52c1 a.123.1.1 (C:528-776) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml
yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn
ssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysng
nikkllfhq

Sequence, based on observed residues (ATOM records): (download)

>d3h52c1 a.123.1.1 (C:528-776) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml
yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn
ssqnsqrfyqltklldsmhevvenllnycfqtfaeiitnqipkysngnikkllfhq

SCOPe Domain Coordinates for d3h52c1:

Click to download the PDB-style file with coordinates for d3h52c1.
(The format of our PDB-style files is described here.)

Timeline for d3h52c1: