Class a: All alpha proteins [46456] (290 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
Domain d3h52c1: 3h52 C:528-776 [177191] Other proteins in same PDB: d3h52a2, d3h52c2 automated match to d1m2za_ complexed with 486, gol |
PDB Entry: 3h52 (more details), 2.8 Å
SCOPe Domain Sequences for d3h52c1:
Sequence, based on SEQRES records: (download)
>d3h52c1 a.123.1.1 (C:528-776) automated matches {Human (Homo sapiens) [TaxId: 9606]} ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn ssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysng nikkllfhq
>d3h52c1 a.123.1.1 (C:528-776) automated matches {Human (Homo sapiens) [TaxId: 9606]} ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn ssqnsqrfyqltklldsmhevvenllnycfqtfaeiitnqipkysngnikkllfhq
Timeline for d3h52c1:
View in 3D Domains from other chains: (mouse over for more information) d3h52a1, d3h52a2, d3h52b_, d3h52d_ |