Lineage for d3h52b_ (3h52 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729657Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)
  8. 2729902Domain d3h52b_: 3h52 B: [177190]
    Other proteins in same PDB: d3h52a2, d3h52c2
    automated match to d1m2za_
    complexed with 486, gol

Details for d3h52b_

PDB Entry: 3h52 (more details), 2.8 Å

PDB Description: crystal structure of the antagonist form of human glucocorticoid receptor
PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3h52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h52b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml
yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn
ssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysng
nikkllfhq

SCOPe Domain Coordinates for d3h52b_:

Click to download the PDB-style file with coordinates for d3h52b_.
(The format of our PDB-style files is described here.)

Timeline for d3h52b_: