SCOPe 2.08: Domain d3h52b_: 3h52 B:

Lineage for d3h52b_ (3h52 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d3h52b_: 3h52 B: [177190]
   Other proteins in same PDB: d3h52a2, d3h52c2
   automated match to d1m2za_
   complexed with 486, gol

Details for d3h52b_

PDB Entry: 3h52, 2.8 Å

PDB Description: crystal structure of the antagonist form of human glucocorticoid receptor

PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3h52b_:

Sequence; same for both SEQRES and ATOM records:

>d3h52b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrnl
hlddqmtllqyswmslmafalgwrsyrqssanllcfapdliineqrmtlpdmydqckhml
yvsselhrlqvsyeeylcmktllllssvpkdglksqalfdairmtyikelgkaivkregn
ssqnsqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysng
nikkllfhq

Timeline for d3h52b_:

• d3h52b_ first appeared in SCOPe 2.01
  
• d3h52b_ appears in SCOPe 2.07