Lineage for d1dugb1 (1dug B:81-220)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996627Protein Class alpha GST [81349] (8 species)
  7. 1996753Species Schistosoma japonicum [TaxId:6182] [47633] (14 PDB entries)
    Uniprot P08515
  8. 1996755Domain d1dugb1: 1dug B:81-220 [17719]
    Other proteins in same PDB: d1duga2, d1dugb2
    fused with synthetic linker-c-terminal fibrinogen gamma chain fragment
    complexed with gsh

Details for d1dugb1

PDB Entry: 1dug (more details), 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization
PDB Compounds: (B:) chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN

SCOPe Domain Sequences for d1dugb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dugb1 a.45.1.1 (B:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdp

SCOPe Domain Coordinates for d1dugb1:

Click to download the PDB-style file with coordinates for d1dugb1.
(The format of our PDB-style files is described here.)

Timeline for d1dugb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dugb2