Lineage for d3h4ve_ (3h4v E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450115Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2450118Species Leishmania major [TaxId:5664] [63926] (14 PDB entries)
    Uniprot Q01782
  8. 2450180Domain d3h4ve_: 3h4v E: [177185]
    automated match to d1e7wa_
    complexed with dvp, nap

Details for d3h4ve_

PDB Entry: 3h4v (more details), 2.4 Å

PDB Description: selective screening and design to identify inhibitors of leishmania major pteridine reductase 1
PDB Compounds: (E:) pteridine reductase 1

SCOPe Domain Sequences for d3h4ve_:

Sequence, based on SEQRES records: (download)

>d3h4ve_ c.2.1.2 (E:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedg
hepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtn
qpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskv
plyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d3h4ve_ c.2.1.2 (E:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrgdreametatad
lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
gltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvi
flcsskakyitgtcvkvdggysltra

SCOPe Domain Coordinates for d3h4ve_:

Click to download the PDB-style file with coordinates for d3h4ve_.
(The format of our PDB-style files is described here.)

Timeline for d3h4ve_: