Lineage for d1duga1 (1dug A:81-220)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. Protein Class alpha GST [81349] (8 species)
  7. Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
    Uniprot P08515
  8. Domain d1duga1: 1dug A:81-220 [17718]
    Other proteins in same PDB: d1duga2, d1dugb2
    fused with synthetic linker-c-terminal fibrinogen gamma chain fragment
    complexed with gsh

Details for d1duga1

PDB Entry: 1dug (more details), 1.8 Å

PDB Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization
PDB Compounds: (A:) chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN

SCOPe Domain Sequences for d1duga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdp

SCOPe Domain Coordinates for d1duga1 are not available.

Timeline for d1duga1:

Domains from same chain:
(mouse over for more information)
d1duga2
Domains from other chains:
(mouse over for more information)
d1dugb1, d1dugb2