Lineage for d3h4sa1 (3h4s A:886-1255)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111787Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188907] (2 PDB entries)
  8. 2111788Domain d3h4sa1: 3h4s A:886-1255 [177179]
    automated match to d1sdma_
    complexed with adp, ca, mg

Details for d3h4sa1

PDB Entry: 3h4s (more details), 2.4 Å

PDB Description: Structure of the complex of a mitotic kinesin with its calcium binding regulator
PDB Compounds: (A:) Kinesin-like calmodulin-binding protein

SCOPe Domain Sequences for d3h4sa1:

Sequence, based on SEQRES records: (download)

>d3h4sa1 c.37.1.9 (A:886-1255) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mkgkirvycrirplnekesserekqmlttvdeftvehpwkddkrkqhiydrvfdmrasqd
difedtkylvqsavdgynvcifaygqtgsgktftiyghesnpgltpratkelfnilkrds
krfsfslkaymvelyqdtlvdlllpksarrlkleikkdskgmvfvenvttipistleelr
milergserrhvsgtnmneessrshlilsvviesidlqtqsaargklsfvdlagservkk
sgsagnqlkeaqsinkslsalgdvigalssgnqhipyrnhkltmlmsdslggnaktlmfv
nvspaesnldetynsllyasrvrtivndpskhisskemvrlkklvaywkeqagkkgeeed
lvdieedrtr

Sequence, based on observed residues (ATOM records): (download)

>d3h4sa1 c.37.1.9 (A:886-1255) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mkgkirvycrirplnekesserekqmlttvdeftvehpwkddkrkqhiydrvfdmrasqd
difedtkylvqsavdgynvcifaygqtgsgktftiyghesnpgltpratkelfnilkrds
krfsfslkaymvelyqdtlvdlllpkrlkleikkdskgmvfvenvttipistleelrmil
ergsereessrshlilsvviesidlqtqsaargklsfvdlagservkksgsagnqlkeaq
sinkslsalgdvigalssgnqhipyrnhkltmlmsdslggnaktlmfvnvspaesnldet
ynsllyasrvrtivndpskhisskemvrlkklvaywkeqagkkgeeedlvdieedrtr

SCOPe Domain Coordinates for d3h4sa1:

Click to download the PDB-style file with coordinates for d3h4sa1.
(The format of our PDB-style files is described here.)

Timeline for d3h4sa1: