Lineage for d3h4nb_ (3h4n B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751105Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1751106Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1751107Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 1751188Protein automated matches [190934] (3 species)
    not a true protein
  7. 1751194Species Geobacter sulfurreducens [TaxId:35554] [189147] (15 PDB entries)
  8. 1751196Domain d3h4nb_: 3h4n B: [177178]
    automated match to d1os6a_
    complexed with hem

Details for d3h4nb_

PDB Entry: 3h4n (more details), 1.35 Å

PDB Description: ppcd, a cytochrome c7 from geobacter sulfurreducens
PDB Compounds: (B:) cytochrome c7

SCOPe Domain Sequences for d3h4nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h4nb_ a.138.1.1 (B:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
kvvvleakngnvtfdhkkhagvkgeckacheteaggkiagmgkdwahktctgchkemgkg
ptkcgechk

SCOPe Domain Coordinates for d3h4nb_:

Click to download the PDB-style file with coordinates for d3h4nb_.
(The format of our PDB-style files is described here.)

Timeline for d3h4nb_: