Class a: All alpha proteins [46456] (286 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
Protein automated matches [190934] (3 species) not a true protein |
Species Geobacter sulfurreducens [TaxId:35554] [189147] (15 PDB entries) |
Domain d3h4nb_: 3h4n B: [177178] automated match to d1os6a_ complexed with hem |
PDB Entry: 3h4n (more details), 1.35 Å
SCOPe Domain Sequences for d3h4nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h4nb_ a.138.1.1 (B:) automated matches {Geobacter sulfurreducens [TaxId: 35554]} kvvvleakngnvtfdhkkhagvkgeckacheteaggkiagmgkdwahktctgchkemgkg ptkcgechk
Timeline for d3h4nb_: