Lineage for d3h4ga_ (3h4g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2080974Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2081106Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)
  8. 2081107Domain d3h4ga_: 3h4g A: [177175]
    automated match to d1ae4a_
    protein/RNA complex; complexed with fid, nap, so4

Details for d3h4ga_

PDB Entry: 3h4g (more details), 1.85 Å

PDB Description: Structure of aldehyde reductase holoenzyme in complex with potent aldose reductase inhibitor Fidarestat: Implications for inhibitor binding and selectivity
PDB Compounds: (A:) Alcohol dehydrogenase [NADP+]

SCOPe Domain Sequences for d3h4ga_:

Sequence, based on SEQRES records: (download)

>d3h4ga_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
maascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigeal
qetvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafer
gdnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrp
avlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaek
ynrspaqillrwqvqrkvicipksvtpsrilqniqvfdftfspeemkqldalnknlrfiv
pmltvdgkrvprdaghplypfndp

Sequence, based on observed residues (ATOM records): (download)

>d3h4ga_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
maascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigeal
qetvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafer
gdnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrp
avlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaek
ynrspaqillrwqvqrkvicipksvtpsrilqniqvfdftfspeemkqldalnknlrfiv
pmltrvprdaghplypfndp

SCOPe Domain Coordinates for d3h4ga_:

Click to download the PDB-style file with coordinates for d3h4ga_.
(The format of our PDB-style files is described here.)

Timeline for d3h4ga_: