![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
![]() | Protein automated matches [190110] (7 species) not a true protein |
![]() | Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries) |
![]() | Domain d3h3xc_: 3h3x C: [177171] Other proteins in same PDB: d3h3xq_, d3h3xr_, d3h3xs_ automated match to d1frfs_ complexed with f3s, fco, gol, mg, ni, sf4; mutant |
PDB Entry: 3h3x (more details), 2.7 Å
SCOPe Domain Sequences for d3h3xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3xc_ e.19.1.1 (C:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]} hrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqal egkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqkak pnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelvh dncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqaghp clgcsepdfwdtmtpfyeqg
Timeline for d3h3xc_: