Lineage for d3h34a_ (3h34 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339824Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2339825Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2339826Family a.138.1.1: Cytochrome c3-like [48696] (5 protein domains)
  6. 2339915Protein automated matches [190934] (3 species)
    not a true protein
  7. 2339921Species Geobacter sulfurreducens [TaxId:35554] [189147] (10 PDB entries)
  8. 2339928Domain d3h34a_: 3h34 A: [177167]
    automated match to d1os6a_
    complexed with hem

Details for d3h34a_

PDB Entry: 3h34 (more details), 1.6 Å

PDB Description: ppce, a cytochrome c7 from geobacter sulfurreducens
PDB Compounds: (A:) cytochrome c7

SCOPe Domain Sequences for d3h34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h34a_ a.138.1.1 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
advilfpskngavtfthkrhsefvrecrschektpgkirnfgkdyahktckgchevrgag
ptkcklchtg

SCOPe Domain Coordinates for d3h34a_:

Click to download the PDB-style file with coordinates for d3h34a_.
(The format of our PDB-style files is described here.)

Timeline for d3h34a_: