| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
| Protein automated matches [190934] (3 species) not a true protein |
| Species Geobacter sulfurreducens [TaxId:35554] [189147] (10 PDB entries) |
| Domain d3h34a_: 3h34 A: [177167] automated match to d1os6a_ complexed with hem |
PDB Entry: 3h34 (more details), 1.6 Å
SCOPe Domain Sequences for d3h34a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h34a_ a.138.1.1 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
advilfpskngavtfthkrhsefvrecrschektpgkirnfgkdyahktckgchevrgag
ptkcklchtg
Timeline for d3h34a_: