Lineage for d3h30a_ (3h30 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435282Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1435283Species Human (Homo sapiens) [TaxId:9606] [75559] (34 PDB entries)
  8. 1435288Domain d3h30a_: 3h30 A: [177164]
    automated match to d1jwha_
    complexed with cl, rfz

Details for d3h30a_

PDB Entry: 3h30 (more details), 1.56 Å

PDB Description: crystal structure of the catalytic subunit of human protein kinase ck2 with 5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3h30a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h30a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarm

SCOPe Domain Coordinates for d3h30a_:

Click to download the PDB-style file with coordinates for d3h30a_.
(The format of our PDB-style files is described here.)

Timeline for d3h30a_: