![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries) |
![]() | Domain d3h2vg1: 3h2v G:59-130 [177162] Other proteins in same PDB: d3h2va_, d3h2vb_, d3h2vc_, d3h2vd_, d3h2ve2, d3h2vf2, d3h2vg2, d3h2vh2 automated match to d1wi6a1 protein/RNA complex |
PDB Entry: 3h2v (more details), 2.9 Å
SCOPe Domain Sequences for d3h2vg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h2vg1 d.58.7.1 (G:59-130) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqsrl rerelsvqlqpt
Timeline for d3h2vg1: