SCOPe 2.07: Domain d3h2vg1: 3h2v G:59-130

Lineage for d3h2vg1 (3h2v G:59-130)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d3h2vg1: 3h2v G:59-130 [177162]
   Other proteins in same PDB: d3h2va_, d3h2vb_, d3h2vc_, d3h2vd_, d3h2ve2, d3h2vf2, d3h2vg2, d3h2vh2
   automated match to d1wi6a1
   protein/RNA complex

Details for d3h2vg1

PDB Entry: 3h2v, 2.9 Å

PDB Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt

PDB Compounds: (G:) Raver-1

SCOPe Domain Sequences for d3h2vg1:

Sequence; same for both SEQRES and ATOM records:

>d3h2vg1 d.58.7.1 (G:59-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqsrl
rerelsvqlqpt

Timeline for d3h2vg1:

• d3h2vg1 first appeared in SCOPe 2.01, called d3h2vg_
  
• d3h2vg1 appears in SCOPe 2.06
  
• d3h2vg1 appears in the current release, SCOPe 2.08