Lineage for d3h2vg_ (3h2v G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908932Domain d3h2vg_: 3h2v G: [177162]
    Other proteins in same PDB: d3h2va_, d3h2vb_, d3h2vc_, d3h2vd_
    automated match to d1wi6a1
    protein/RNA complex

Details for d3h2vg_

PDB Entry: 3h2v (more details), 2.9 Å

PDB Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt
PDB Compounds: (G:) Raver-1

SCOPe Domain Sequences for d3h2vg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h2vg_ d.58.7.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqs
rlrerelsvqlqpt

SCOPe Domain Coordinates for d3h2vg_:

Click to download the PDB-style file with coordinates for d3h2vg_.
(The format of our PDB-style files is described here.)

Timeline for d3h2vg_: