SCOPe 2.01: Domain d3h2vg_: 3h2v G:

Lineage for d3h2vg_ (3h2v G:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries)

8. Domain d3h2vg_: 3h2v G: [177162]
   automated match to d1wi6a1
   protein/RNA complex

Details for d3h2vg_

PDB Entry: 3h2v, 2.9 Å

PDB Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt

PDB Compounds: (G:) Raver-1

SCOPe Domain Sequences for d3h2vg_:

Sequence; same for both SEQRES and ATOM records:

>d3h2vg_ d.58.7.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmrkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqs
rlrerelsvqlqpt

Timeline for d3h2vg_:

• d3h2vg_ is new in SCOPe 2.01-stable
  
• d3h2vg_ appears in SCOPe 2.02
  
• d3h2vg_ appears in the current release, SCOPe 2.08, called d3h2vg1