Lineage for d3h2ve1 (3h2v E:59-130)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195562Domain d3h2ve1: 3h2v E:59-130 [177160]
    Other proteins in same PDB: d3h2va_, d3h2vb_, d3h2vc_, d3h2vd_, d3h2ve2, d3h2vf2, d3h2vg2, d3h2vh2
    automated match to d1wi6a1
    protein/RNA complex

Details for d3h2ve1

PDB Entry: 3h2v (more details), 2.9 Å

PDB Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt
PDB Compounds: (E:) Raver-1

SCOPe Domain Sequences for d3h2ve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h2ve1 d.58.7.1 (E:59-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaainafhqsrl
rerelsvqlqpt

SCOPe Domain Coordinates for d3h2ve1:

Click to download the PDB-style file with coordinates for d3h2ve1.
(The format of our PDB-style files is described here.)

Timeline for d3h2ve1: