SCOP 1.75: Domain d1gsqa1: 1gsq A:76-202

Lineage for d1gsqa1 (1gsq A:76-202)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [47631] (2 PDB entries)

8. Domain d1gsqa1: 1gsq A:76-202 [17716]
   Other proteins in same PDB: d1gsqa2
   complexed with gdb

Details for d1gsqa1

PDB Entry: 1gsq, 2.4 Å

PDB Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods

PDB Compounds: (A:) glutathione s-transferase

SCOP Domain Sequences for d1gsqa1:

Sequence; same for both SEQRES and ATOM records:

>d1gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf

Timeline for d1gsqa1:

• d1gsqa1 first appeared (with stable ids) in SCOP 1.55, called d1gsq_1
  
• d1gsqa1 appears in SCOP 1.73
  
• d1gsqa1 appears in SCOPe 2.01
  
• d1gsqa1 appears in the current release, SCOPe 2.08