| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Daboia russellii [TaxId:31159] [188906] (1 PDB entry) |
| Domain d3h1xa_: 3h1x A: [177152] automated match to d1tgma_ complexed with imn, so4 |
PDB Entry: 3h1x (more details), 1.4 Å
SCOPe Domain Sequences for d3h1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1xa_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 31159]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
Timeline for d3h1xa_: