Lineage for d3h1xa_ (3h1x A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733376Species Daboia russellii [TaxId:31159] [188906] (1 PDB entry)
  8. 2733377Domain d3h1xa_: 3h1x A: [177152]
    automated match to d1tgma_
    complexed with imn, so4

Details for d3h1xa_

PDB Entry: 3h1x (more details), 1.4 Å

PDB Description: Simultaneous inhibition of anti-coagulation and inflammation: Crystal structure of phospholipase A2 complexed with indomethacin at 1.4 A resolution reveals the presence of the new common ligand binding site
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d3h1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h1xa_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 31159]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d3h1xa_:

Click to download the PDB-style file with coordinates for d3h1xa_.
(The format of our PDB-style files is described here.)

Timeline for d3h1xa_: