| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein automated matches [190406] (19 species) not a true protein |
| Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries) |
| Domain d3h1ra_: 3h1r A: [177151] automated match to d1uisa_ |
PDB Entry: 3h1r (more details), 2.41 Å
SCOPe Domain Sequences for d3h1ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1ra_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elitenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatsf
mygshtfinhtqgipdfwkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnfpsngpvmqkktlgweahtemlypadgglegradlalklvggghlicnfkttyrskk
paknlkmpgvyyvdyrlerikeadketyveqhevavarycdlpskl
Timeline for d3h1ra_: