SCOPe 2.02: Domain d3h1oa_: 3h1o A:

Lineage for d3h1oa_ (3h1o A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (17 PDB entries)

8. Domain d3h1oa_: 3h1o A: [177149]
   automated match to d1uisa_
   complexed with gol

Details for d3h1oa_

PDB Entry: 3h1o, 2 Å

PDB Description: the structure of fluorescent protein fp480

PDB Compounds: (A:) Fluorescent protein FP480

SCOPe Domain Sequences for d3h1oa_:

Sequence; same for both SEQRES and ATOM records:

>d3h1oa_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elitenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatsf
mygshtfinhtqgipdfwkqsfpegftwervttyedggvltatqdtslqdgcliynvkir
gvnfpsngpvmqkktlgweahtemlypadgglegradlalklvggghlicnfkttyrskk
paknlkmpgvyyvdyrlerikeadketyveqhevavarycdlpskl

Timeline for d3h1oa_:

• d3h1oa_ first appeared in SCOPe 2.01
  
• d3h1oa_ appears in SCOPe 2.03
  
• d3h1oa_ appears in the current release, SCOPe 2.08