Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (17 PDB entries) |
Domain d3h1oa_: 3h1o A: [177149] automated match to d1uisa_ complexed with gol |
PDB Entry: 3h1o (more details), 2 Å
SCOPe Domain Sequences for d3h1oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1oa_ d.22.1.1 (A:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} elitenmhmklymegtvnnhhfkctsegegkpyegtqtqrikvveggplpfafdilatsf mygshtfinhtqgipdfwkqsfpegftwervttyedggvltatqdtslqdgcliynvkir gvnfpsngpvmqkktlgweahtemlypadgglegradlalklvggghlicnfkttyrskk paknlkmpgvyyvdyrlerikeadketyveqhevavarycdlpskl
Timeline for d3h1oa_: