| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein CheY protein [52174] (5 species) |
| Species Helicobacter pylori [TaxId:85962] [189261] (1 PDB entry) |
| Domain d3h1ga_: 3h1g A: [177148] automated match to d2chea_ complexed with mg, so4; mutant |
PDB Entry: 3h1g (more details), 1.7 Å
SCOPe Domain Sequences for d3h1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1ga_ c.23.1.1 (A:) CheY protein {Helicobacter pylori [TaxId: 85962]}
mkllvvddsstmrriikntlsrlgyedvleaehgveawekldanadtkvlitdwnmpemn
gldlvkkvrsdsrfkeipiimitaeggkaevitalkagvnnyivkpftpqvlkeklevvl
gtn
Timeline for d3h1ga_: