Lineage for d3h11b_ (3h11 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2101069Protein Caspase-8 [52135] (1 species)
  7. 2101070Species Human (Homo sapiens) [TaxId:9606] [52136] (7 PDB entries)
  8. 2101072Domain d3h11b_: 3h11 B: [177145]
    Other proteins in same PDB: d3h11a_
    automated match to d1i4eb_

Details for d3h11b_

PDB Entry: 3h11 (more details), 1.9 Å

PDB Description: Zymogen caspase-8:c-FLIPL protease domain complex
PDB Compounds: (B:) caspase-8

SCOPe Domain Sequences for d3h11b_:

Sequence, based on SEQRES records: (download)

>d3h11b_ c.17.1.1 (B:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
dkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfeik
phddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqftg
lkcpslagkpkvffiqacqgdnyqkgipvetaseeqpylemalsspqtryipdeadfllg
matvnncvsyrnpaegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkq
mpqptftlrkklvfpsd

Sequence, based on observed residues (ATOM records): (download)

>d3h11b_ c.17.1.1 (B:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]}
dkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfeik
phddctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqftg
lkcpslagkpkvffiqacqgdnyqqtryipdeadfllgmatvnncvsyrnpaegtwyiqs
lcqslrercprgddiltiltevnyevsnkgkqmpqptftlrkklvfpsd

SCOPe Domain Coordinates for d3h11b_:

Click to download the PDB-style file with coordinates for d3h11b_.
(The format of our PDB-style files is described here.)

Timeline for d3h11b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3h11a_