SCOPe 2.02: Domain d3h10b_: 3h10 B:

Lineage for d3h10b_ (3h10 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)

8. Domain d3h10b_: 3h10 B: [177143]
   automated match to d1ol5a_
   complexed with 97b

Details for d3h10b_

PDB Entry: 3h10, 2.2 Å

PDB Description: aurora a inhibitor complex

PDB Compounds: (B:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d3h10b_:

Sequence; same for both SEQRES and ATOM records:

>d3h10b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
sychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemiegr
mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
khnpsqrpmlrevlehpwitansskps

Timeline for d3h10b_:

• d3h10b_ first appeared in SCOPe 2.01
  
• d3h10b_ appears in SCOPe 2.03
  
• d3h10b_ appears in the current release, SCOPe 2.08