Lineage for d3h0zc_ (3h0z C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542390Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 2542391Species Human (Homo sapiens) [TaxId:9606] [90039] (72 PDB entries)
  8. 2542431Domain d3h0zc_: 3h0z C: [177141]
    automated match to d1ol5a_
    complexed with 45b

Details for d3h0zc_

PDB Entry: 3h0z (more details), 2.92 Å

PDB Description: Aurora A in complex with a bisanilinopyrimidine
PDB Compounds: (C:) serine/threonine-protein kinase 6

SCOPe Domain Sequences for d3h0zc_:

Sequence, based on SEQRES records: (download)

>d3h0zc_ d.144.1.7 (C:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrraalcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanss

Sequence, based on observed residues (ATOM records): (download)

>d3h0zc_ d.144.1.7 (C:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadtldylppemiegrmhdekvdlwslgvlcyef
lvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpw
itanss

SCOPe Domain Coordinates for d3h0zc_:

Click to download the PDB-style file with coordinates for d3h0zc_.
(The format of our PDB-style files is described here.)

Timeline for d3h0zc_: