Lineage for d3h0ib_ (3h0i B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783006Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species)
  7. 2783010Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries)
  8. 2783025Domain d3h0ib_: 3h0i B: [177135]
    automated match to d1efna_
    mutant

Details for d3h0ib_

PDB Entry: 3h0i (more details), 2.2 Å

PDB Description: human fyn sh3 domain r96i mutant, crystal form ii
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d3h0ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0ib_ b.34.2.1 (B:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
vtlfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd

SCOPe Domain Coordinates for d3h0ib_:

Click to download the PDB-style file with coordinates for d3h0ib_.
(The format of our PDB-style files is described here.)

Timeline for d3h0ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3h0ia_