Lineage for d3h0ia_ (3h0i A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.2: SH3-domain [50044] (2 families) 
Family b.34.2.1: SH3-domain [50045] (40 proteins) 
Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries) 
Domain d3h0ia_: 3h0i A: [177134]
automated match to d1efna_
mutant
Details for d3h0ia_
PDB Entry: 3h0i (more details), 2.2 Å
PDB Description: human fyn sh3 domain r96i mutant, crystal form ii
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase FynSCOPe Domain Sequences for d3h0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h0ia_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
vtlfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd
SCOPe Domain Coordinates for d3h0ia_:
Click to download the PDB-style file with coordinates for d3h0ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h0ia_:
- d3h0ia_ first appeared in SCOPe 2.01
- d3h0ia_ appears in SCOPe 2.07
View in 3D
