| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50049] (18 PDB entries) |
| Domain d3h0ha_: 3h0h A: [177133] automated match to d1efna_ complexed with pg4; mutant |
PDB Entry: 3h0h (more details), 1.76 Å
SCOPe Domain Sequences for d3h0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h0ha_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
ggtgvtlfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyva
pvd
Timeline for d3h0ha_: