Lineage for d3h0fa_ (3h0f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783006Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (2 species)
  7. 2783010Species Human (Homo sapiens) [TaxId:9606] [50049] (32 PDB entries)
  8. 2783028Domain d3h0fa_: 3h0f A: [177132]
    automated match to d1m27c_
    complexed with pg5; mutant

Details for d3h0fa_

PDB Entry: 3h0f (more details), 2.61 Å

PDB Description: crystal structure of the human fyn sh3 r96w mutant
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Fyn

SCOPe Domain Sequences for d3h0fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0fa_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
vtlfvalydyeawteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapvd

SCOPe Domain Coordinates for d3h0fa_:

Click to download the PDB-style file with coordinates for d3h0fa_.
(The format of our PDB-style files is described here.)

Timeline for d3h0fa_: