Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class sigma GST [81351] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47630] (1 PDB entry) synonym: hematopoietic prostaglandin D synthase |
Domain d1pd211: 1pd2 1:76-199 [17713] Other proteins in same PDB: d1pd212, d1pd222 complexed with gsh |
PDB Entry: 1pd2 (more details), 2.3 Å
SCOPe Domain Sequences for d1pd211:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd211 a.45.1.1 (1:76-199) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]} dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp qtkl
Timeline for d1pd211: