SCOP 1.57: Domain d1pd211: 1pd2 1:76-199

Lineage for d1pd211 (1pd2 1:76-199)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Rat (Rattus norvegicus), class sigma [TaxId:10116] [47630] (1 PDB entry)

8. Domain d1pd211: 1pd2 1:76-199 [17713]
   Other proteins in same PDB: d1pd212, d1pd222

Details for d1pd211

PDB Entry: 1pd2, 2.3 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase complex with glutathione

SCOP Domain Sequences for d1pd211:

Sequence; same for both SEQRES and ATOM records:

>d1pd211 a.45.1.1 (1:76-199) Glutathione S-transferase {Rat (Rattus norvegicus), class sigma}
dlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndlltrqaphllkdldtyl
gdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkvqaipaisawilkrp
qtkl

Timeline for d1pd211:

• d1pd211 first appeared (with stable ids) in SCOP 1.55
  
• d1pd211 appears in SCOP 1.59
  
• d1pd211 appears in the current release, SCOPe 2.08