![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
![]() | Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
![]() | Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins) contains one additional helix in the C-terminal extension automatically mapped to Pfam PF00926 |
![]() | Protein automated matches [190415] (4 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [188881] (1 PDB entry) |
![]() | Domain d3h07a_: 3h07 A: [177123] automated match to d1ieza_ |
PDB Entry: 3h07 (more details), 1.95 Å
SCOPe Domain Sequences for d3h07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h07a_ d.115.1.2 (A:) automated matches {Yersinia pestis [TaxId: 214092]} tllsdfgtpververaidalrngrgvmvlddesrenegdmvfaaeamtleqmaltirhgs givclcitderrqqldlpmmvthnssqfqtaftvtieaaegvttgvsaadrlttirkaia dnakpadlnrpghvfplrgqpggvlsrrghteasidlatlagykpagvlceltnddgsma hapeviafaklhdmpvvtiddlaaylqsr
Timeline for d3h07a_: