SCOPe 2.08: Domain d3h07a_: 3h07 A:

Lineage for d3h07a_ (3h07 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
   contains one additional helix in the C-terminal extension
   automatically mapped to Pfam PF00926

6. Protein automated matches [190415] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [188881] (1 PDB entry)

8. Domain d3h07a_: 3h07 A: [177123]
   automated match to d1ieza_

Details for d3h07a_

PDB Entry: 3h07, 1.95 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase from yersinia pestis co92

PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3h07a_:

Sequence; same for both SEQRES and ATOM records:

>d3h07a_ d.115.1.2 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
tllsdfgtpververaidalrngrgvmvlddesrenegdmvfaaeamtleqmaltirhgs
givclcitderrqqldlpmmvthnssqfqtaftvtieaaegvttgvsaadrlttirkaia
dnakpadlnrpghvfplrgqpggvlsrrghteasidlatlagykpagvlceltnddgsma
hapeviafaklhdmpvvtiddlaaylqsr

Timeline for d3h07a_:

• d3h07a_ first appeared in SCOPe 2.01
  
• d3h07a_ appears in SCOPe 2.07