SCOPe 2.01: Domain d3h06h_: 3h06 H:

Lineage for d3h06h_ (3h06 H:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (101 PDB entries)

8. Domain d3h06h_: 3h06 H: [177120]
   automated match to d1ftja_
   complexed with vbp

Details for d3h06h_

PDB Entry: 3h06, 2.8 Å

PDB Description: crystal structure of the binding domain of the ampa subunit glur2 bound to the willardiine antagonist, ubp282

PDB Compounds: (H:) Glutamate receptor 2

SCOPe Domain Sequences for d3h06h_:

Sequence; same for both SEQRES and ATOM records:

>d3h06h_ c.94.1.1 (H:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

Timeline for d3h06h_:

• d3h06h_ is new in SCOPe 2.01-stable
  
• d3h06h_ appears in SCOPe 2.02
  
• d3h06h_ appears in the current release, SCOPe 2.08