SCOPe 2.08: Domain d3ljrb1: 3ljr B:80-244

Lineage for d3ljrb1 (3ljr B:80-244)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class theta GST [81350] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)

8. Domain d3ljrb1: 3ljr B:80-244 [17712]
   Other proteins in same PDB: d3ljra2, d3ljrb2
   complexed with ggc, so4

Details for d3ljrb1

PDB Entry: 3ljr, 3.3 Å

PDB Description: glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d3ljrb1:

Sequence; same for both SEQRES and ATOM records:

>d3ljrb1 a.45.1.1 (B:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

Timeline for d3ljrb1:

• d3ljrb1 first appeared (with stable ids) in SCOP 1.55
  
• d3ljrb1 appears in SCOPe 2.07