Lineage for d3gzsb_ (3gzs B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007586Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2007587Protein automated matches [191037] (12 species)
    not a true protein
  7. 2007588Species Bacteroides fragilis [TaxId:272559] [188861] (2 PDB entries)
  8. 2007592Domain d3gzsb_: 3gzs B: [177117]
    automated match to d3cgha1
    complexed with act, gol

Details for d3gzsb_

PDB Entry: 3gzs (more details), 2.09 Å

PDB Description: crystal structure of a susd superfamily protein (bf3413) from bacteroides fragilis nctc 9343 at 2.10 a resolution
PDB Compounds: (B:) Uncharacterized SusD superfamily protein

SCOPe Domain Sequences for d3gzsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzsb_ a.118.8.0 (B:) automated matches {Bacteroides fragilis [TaxId: 272559]}
gviygaylpnleksvipigtasestepvnryqigvnlagdawagymsprdnkfngsknft
nyfmyenwvnyvysfmvtdvyspwmqikrisqdegtrndeiyalaqiikiaalhrttdmf
gpipysqvgkgsfkvaydsqesvyrsflkeleeavqtlddysnkskevlpafdivyngdv
nkwmrfanslmlrlairvrfadaglakeyaekavkhpaglinskelaaqmgkgaglqmkn
plkvineeyndtrmgatiysylagyndaraavyfvknngfkavrcgiaksgdayngftrp
nvheddplywmkasevcflkaegalagfdmggsagdfynagirmsfsengldnssaetyl
kdstrkpanytdtsngelsanapssitirwengateeekleriitqkylaifpngqeawt
ewrrtgyprqivvaenktnsavligngydlggvrrlpyprteyeqngenlhnaisqylgg
vdnaatkvwwdkksk

SCOPe Domain Coordinates for d3gzsb_:

Click to download the PDB-style file with coordinates for d3gzsb_.
(The format of our PDB-style files is described here.)

Timeline for d3gzsb_: