Lineage for d3gzsa_ (3gzs A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334081Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2334082Protein automated matches [191037] (12 species)
    not a true protein
  7. 2334083Species Bacteroides fragilis [TaxId:272559] [188861] (2 PDB entries)
  8. 2334086Domain d3gzsa_: 3gzs A: [177116]
    automated match to d3cgha1
    complexed with act, gol

Details for d3gzsa_

PDB Entry: 3gzs (more details), 2.09 Å

PDB Description: crystal structure of a susd superfamily protein (bf3413) from bacteroides fragilis nctc 9343 at 2.10 a resolution
PDB Compounds: (A:) Uncharacterized SusD superfamily protein

SCOPe Domain Sequences for d3gzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzsa_ a.118.8.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
gviygaylpnleksvipigtasestepvnryqigvnlagdawagymsprdnkfngsknft
nyfmyenwvnyvysfmvtdvyspwmqikrisqdegtrndeiyalaqiikiaalhrttdmf
gpipysqvgkgsfkvaydsqesvyrsflkeleeavqtlddysnkskevlpafdivyngdv
nkwmrfanslmlrlairvrfadaglakeyaekavkhpaglinskelaaqmgkgaglqmkn
plkvineeyndtrmgatiysylagyndaraavyfvknngfkavrcgiaksgdayngftrp
nvheddplywmkasevcflkaegalagfdmggsagdfynagirmsfsengldnssaetyl
kdstrkpanytdtsngelsanapssitirwengateeekleriitqkylaifpngqeawt
ewrrtgyprqivvaenktnsavligngydlggvrrlpyprteyeqngenlhnaisqylgg
vdnaatkvwwdkksk

SCOPe Domain Coordinates for d3gzsa_:

Click to download the PDB-style file with coordinates for d3gzsa_.
(The format of our PDB-style files is described here.)

Timeline for d3gzsa_: