![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (14 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188862] (2 PDB entries) |
![]() | Domain d3gzmb_: 3gzm B: [177113] automated match to d1acpa_ complexed with bme, mli, pns |
PDB Entry: 3gzm (more details), 1.8 Å
SCOPe Domain Sequences for d3gzmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzmb_ a.28.1.0 (B:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} sslkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdq dalkintvqdaidyieknnkq
Timeline for d3gzmb_: