Class a: All alpha proteins [46456] (284 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (1 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188862] (2 PDB entries) |
Domain d3gzma_: 3gzm A: [177112] automated match to d1acpa_ complexed with bme, mli, pns |
PDB Entry: 3gzm (more details), 1.8 Å
SCOPe Domain Sequences for d3gzma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzma_ a.28.1.0 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} slkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdqd alkintvqdaidyieknn
Timeline for d3gzma_: