SCOPe 2.02: Domain d3gzje_: 3gzj E:

Lineage for d3gzje_ (3gzj E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)

6. Protein automated matches [191073] (1 species)
   not a true protein

7. Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries)

8. Domain d3gzje_: 3gzj E: [177110]
   automated match to d1y7ha_
   complexed with evs

Details for d3gzje_

PDB Entry: 3gzj, 2.19 Å

PDB Description: crystal structure of polyneuridine aldehyde esterase complexed with 16-epi-vellosimine

PDB Compounds: (E:) Polyneuridine-aldehyde esterase

SCOPe Domain Sequences for d3gzje_:

Sequence; same for both SEQRES and ATOM records:

>d3gzje_ c.69.1.20 (E:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
qkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdyseplm
evmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfekyn
ekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslff
qdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgmls
qprevckclldisd

Timeline for d3gzje_:

• d3gzje_ first appeared in SCOPe 2.01
  
• d3gzje_ appears in SCOPe 2.03
  
• d3gzje_ appears in the current release, SCOPe 2.08