| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins) automatically mapped to Pfam PF12697 |
| Protein automated matches [191073] (1 species) not a true protein |
| Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries) |
| Domain d3gzja_: 3gzj A: [177106] automated match to d1y7ha_ complexed with evs |
PDB Entry: 3gzj (more details), 2.19 Å
SCOPe Domain Sequences for d3gzja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzja_ c.69.1.20 (A:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
qkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdyseplm
evmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfekyn
ekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslff
qdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgmls
qprevckclldisd
Timeline for d3gzja_:
View in 3DDomains from other chains: (mouse over for more information) d3gzjb_, d3gzjc_, d3gzjd_, d3gzje_ |