SCOPe 2.05: Domain d3gz4b_: 3gz4 B:

Lineage for d3gz4b_ (3gz4 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Escherichia coli [TaxId:217992] [188734] (2 PDB entries)

8. Domain d3gz4b_: 3gz4 B: [177104]
   automated match to d2c07a1
   complexed with ndp

Details for d3gz4b_

PDB Entry: 3gz4, 2.1 Å

PDB Description: crystal structure of putative short chain dehydrogenase from escherichia coli cft073 complexed with nadph

PDB Compounds: (B:) Hypothetical oxidoreductase yciK

SCOPe Domain Sequences for d3gz4b_:

Sequence; same for both SEQRES and ATOM records:

>d3gz4b_ c.2.1.0 (B:) automated matches {Escherichia coli [TaxId: 217992]}
pkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrqp
qwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwqdvmqvn
vnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladeyq
qrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtfdaqp

Timeline for d3gz4b_:

• d3gz4b_ first appeared in SCOPe 2.01
  
• d3gz4b_ appears in SCOPe 2.04
  
• d3gz4b_ appears in SCOPe 2.06
  
• d3gz4b_ appears in the current release, SCOPe 2.08