Lineage for d3gyse_ (3gys E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717898Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries)
  8. 1717919Domain d3gyse_: 3gys E: [177100]
    automated match to d1a00a_
    complexed with hem

Details for d3gyse_

PDB Entry: 3gys (more details), 2.9 Å

PDB Description: crystal structure determination of cat (felis silvestris catus) hemoglobin at 2.9 angstrom resolution
PDB Compounds: (E:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gyse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gyse_ a.1.1.2 (E:) automated matches {Cat (Felis catus) [TaxId: 9685]}
vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
vhasldkffsavstvlts

SCOPe Domain Coordinates for d3gyse_:

Click to download the PDB-style file with coordinates for d3gyse_.
(The format of our PDB-style files is described here.)

Timeline for d3gyse_: